PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG110500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 675aa    MW: 76215.4 Da    PI: 7.2202
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG110500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.16.3e-1033066711369
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+avs ++++la+ +L+ ++++as +gd  qRla++++  L+ rla+++s+ly+++ +++ +    ++ l++++l   +sP+
  Pavir.9KG110500.1.p 306 LRTLLIHCAQAVSVNNHTLASDILSIIRQHASTSGDDSQRLAFCLADCLEVRLAGTGSQLYRKMMAKRRK---AVDILKVFHLCIAISPF 392
                          6789**********************************************************99999888...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           ++ +   N++I +  +g+ rvHiiDf+i  G+QWp+L+++La+R++gpp++RiTg+++p++g   +e+ ++tg rLa++A+ +++pfe+
  Pavir.9KG110500.1.p 393 SRVPYYFSNKTIIDVSKGKPRVHIIDFGICFGFQWPSLFEQLAKREGGPPMVRITGIEQPQPGfrPNESSKNTGPRLADYASMFNIPFEY 482
                          ****************************************************************9************************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +++++e++++++++++++++++Vn+++ l++l de+vs++s+r++vL++++ l+Pkv+++   + ++ ++ Fl+rf + ++++salf
  Pavir.9KG110500.1.p 483 QG-ISSKWETIKIDDFKIEKDDVVIVNCIYCLKNLGDETVSINSARNRVLNTIRMLKPKVFIHGVVNGSYITPFFLTRFKKVMYHHSALF 571
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d ++++lpr++e+r+ +Er + +  + nv+aceg+er+er e+++kW+ r ++aGF++++l+ ++++  +++++++++d + ++e++++l
  Pavir.9KG110500.1.p 572 DVIDKTLPRDAEARMILERDIYRSTVLNVIACEGSERIERPESYKKWKLRNKKAGFEQLQLNPDTVEGTRAMVKQYHKD-FVINEDDQWL 660
                          *****************************************************************************77.********** PP

                 GRAS 359 vlgWkdrpLvs 369
                          +lgWk+r L+ 
  Pavir.9KG110500.1.p 661 LLGWKGRILYG 671
                          ********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.084280657IPR005202Transcription factor GRAS
PfamPF035142.2E-100306671IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
NTPGCYASSL KFMDPANKYS DLDLVFHQTS SIDHFPPVAT TVNNDACVAS SASSSSKIYA  60
PQSCEVSSNV TPDWYGTNVA EYSEESWINS DTSTTINKLL MQEDSDEKFK SHHGKSALRA  120
MEEPLYKLVG QNYPANTQLL PVCSCDHPNT PDGSISKFNG QPCSNCSVAI SSGNNHYNDN  180
LQAFEAPWSL SDIVGDIRQF TQDTYTTELG LNAGGLSIVE NNNRYNQSLQ INVGESRKHA  240
FFEVQCRKMN SHKEDLDLLE GRSNKQFAIS FNEPTRDEIF DKVLLCSEHE PVEQGKKQQR  300
KEMVDLRTLL IHCAQAVSVN NHTLASDILS IIRQHASTSG DDSQRLAFCL ADCLEVRLAG  360
TGSQLYRKMM AKRRKAVDIL KVFHLCIAIS PFSRVPYYFS NKTIIDVSKG KPRVHIIDFG  420
ICFGFQWPSL FEQLAKREGG PPMVRITGIE QPQPGFRPNE SSKNTGPRLA DYASMFNIPF  480
EYQGISSKWE TIKIDDFKIE KDDVVIVNCI YCLKNLGDET VSINSARNRV LNTIRMLKPK  540
VFIHGVVNGS YITPFFLTRF KKVMYHHSAL FDVIDKTLPR DAEARMILER DIYRSTVLNV  600
IACEGSERIE RPESYKKWKL RNKKAGFEQL QLNPDTVEGT RAMVKQYHKD FVINEDDQWL  660
LLGWKGRILY GMAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-413106698368GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466849.10.0hypothetical protein SORBIDRAFT_01g015170
TrEMBLK4ALU30.0K4ALU3_SETIT; Uncharacterized protein
STRINGSi039877m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-126GRAS family protein